PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759684.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 436aa    MW: 48975.5 Da    PI: 7.5216
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759684.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS349.26.6e-107454301373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++ s+g+l+ a+a+L+++ +las +gd+mqRlaa f+  La rl++ ++++ykal+    s  + ++  +++ +f +++P+l +++
  XP_009759684.1  45 LIQLLLTCANHASTGNLHHADACLSQILQLASITGDSMQRLAAWFASSLAIRLVKRWPGIYKALNHGVPS--RIVDLDQSRIIFAKAFPYLGLAY 137
                     689*************************************************************887777..37777777888************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      + N+ + +a+++++ +Hi+D++ +    W+++l+ + + p+++p+l+iT v++    +k +lee+++r++k A++l+++f+fn l   +l +l+
  XP_009759684.1 138 AVINRVLIQAMSEDRIIHIVDLGSGDTKLWIPFLKNIVNLPNETPNLKITCVNN----NKAMLEEMASRIKKEAKALDISFQFNSL-NVDLRELT 227
                     ******************************************************....9**************************5.889***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                     l++L+vk gE+la  +vl+lh ll                 +++v+  ++ +e+L ++ slsPkv+++veqeadhn +++++rf+e l+yysalf
  XP_009759684.1 228 LDMLKVKAGESLAFVSVLNLHVLLveddrinsqfnlnknnnNNNVKDCKRMSEFLTMLHSLSPKVLILVEQEADHNLSKLVDRFVEGLHYYSALF 322
                     **************************************98877777777999******************************************* PP

            GRAS 269 dsleaklpres....eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                     ds+++++   +    eer+ vE++ lg+ei+n+vaceg er+erhe+++kW  rl++ GF+pv+l ++++++ak+l++ +++dgy++ +++gsl+
  XP_009759684.1 323 DSIDTTFKGSNcslcEERVAVEQM-LGKEIENMVACEGLEREERHERFGKWIVRLTRGGFRPVRLWYDIMEDAKRLVEAYGGDGYKIISQKGSLM 416
                     ******998889999*********.********************************************************************** PP

            GRAS 360 lgWkdrpLvsvSaW 373
                     ++W+drp++svSaW
  XP_009759684.1 417 ICWHDRPIYSVSAW 430
                     ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.09319411IPR005202Transcription factor GRAS
PfamPF035142.3E-10445430IPR005202Transcription factor GRAS
Gene3DG3DSA:3.40.50.1501.8E-5140221IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MNISSPAIKP DVTLSLTLSS STSSTTTTTD ASTDALNPKE RGVKLIQLLL TCANHASTGN  60
LHHADACLSQ ILQLASITGD SMQRLAAWFA SSLAIRLVKR WPGIYKALNH GVPSRIVDLD  120
QSRIIFAKAF PYLGLAYAVI NRVLIQAMSE DRIIHIVDLG SGDTKLWIPF LKNIVNLPNE  180
TPNLKITCVN NNKAMLEEMA SRIKKEAKAL DISFQFNSLN VDLRELTLDM LKVKAGESLA  240
FVSVLNLHVL LVEDDRINSQ FNLNKNNNNN NVKDCKRMSE FLTMLHSLSP KVLILVEQEA  300
DHNLSKLVDR FVEGLHYYSA LFDSIDTTFK GSNCSLCEER VAVEQMLGKE IENMVACEGL  360
EREERHERFG KWIVRLTRGG FRPVRLWYDI MEDAKRLVEA YGGDGYKIIS QKGSLMICWH  420
DRPIYSVSAW NCAFIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-30434312375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0126390.0AB012639.1 Nicotiana sylvestris Lhcb1*7 gene for light harvesting chlorophyll a/b-binding protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759684.10.0PREDICTED: scarecrow-like protein 3
TrEMBLA0A0D2M1880.0A0A0D2M188_G
STRINGPOPTR_0004s21850.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA135701216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-108scarecrow-like 3